PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G2408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 259aa    MW: 29127.6 Da    PI: 8.5932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G2408genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed ll+++++ +G g+W++ +++ g+ R++k+c++rw +yl
      Gh_A08G2408 14 RGPWTAREDTLLIKYIQAHGEGHWRSLPKMAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding55.41.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++Ed+l+++++ +lG++ W++Ia++++ gRt++++k++w+++l
      Gh_A08G2408  67 RGNITPDEDDLIIRLHSLLGNR-WSLIAKRLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.08961IPR017930Myb domain
SuperFamilySSF466891.95E-3011108IPR009057Homeodomain-like
SMARTSM007173.4E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-231568IPR009057Homeodomain-like
CDDcd001674.88E-101661No hitNo description
PROSITE profilePS5129427.4962116IPR017930Myb domain
SMARTSM007173.2E-1766114IPR001005SANT/Myb domain
PfamPF002492.9E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2669115IPR009057Homeodomain-like
CDDcd001678.28E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRAPCCSKV GLNRGPWTAR EDTLLIKYIQ AHGEGHWRSL PKMAGLLRCG KSCRLRWINY  60
LRPDIKRGNI TPDEDDLIIR LHSLLGNRWS LIAKRLPGRT DNEIKNYWNS HLSKRVLNNS  120
QTNSTTRSSR KAKKATEKKQ KANNVEEKEE IKVLHQPKAS RVSPFSVISR SSSFDSLISG  180
SSSSGEGSKG TNDAYVFYIP SYWSDFAADT NLEFPDAEAF SDATPVGDSN LLDDIFEEYQ  240
KLLDGDDPGE RDSIFDVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.209580.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591193e-67AJ459119.1 Gossypium hirsutum partial myb102c gene, clone pGhMYB102c.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474805.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D2PB870.0A0A0D2PB87_G
STRINGPOPTR_0001s11100.17e-94(Populus trichocarpa)
STRINGPOPTR_0003s14420.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-66myb domain protein 111